PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG775900.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 229aa    MW: 26125.9 Da    PI: 9.5462
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG775900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.91.5e-29959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krien + rqvtfskRr g+lKKA+ELSvLCdaeva+i++s++gklye++s
  Pavir.9NG775900.2.p  9 KRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIVISPRGKLYEFAS 59
                         79***********************************************86 PP

2K-box71.91.9e-2480173699
                K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                          ++++++++ e+ + +++ L k++e L+  +R+llGe+Le++s++eL++Le +Leksl  iR +K++ll eq+++l++ke  l+++n++Lr
  Pavir.9NG775900.2.p  80 SSKTAQQDIEQVKADAQGLAKKLEALEAYKRKLLGEKLEECSIEELHSLEVKLEKSLHCIRGRKTQLLEEQVNKLKEKEMTLRKNNEDLR 169
                          334788999********************************************************************************* PP

                K-box  96 kkle 99 
                          +k +
  Pavir.9NG775900.2.p 170 EKCK 173
                          *976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.852161IPR002100Transcription factor, MADS-box
SMARTSM004329.8E-39160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.18E-30383IPR002100Transcription factor, MADS-box
CDDcd002652.11E-39377No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-30323IPR002100Transcription factor, MADS-box
PfamPF003197.0E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-303859IPR002100Transcription factor, MADS-box
PfamPF014865.8E-2584173IPR002487Transcription factor, K-box
PROSITE profilePS5129713.40388178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MVRGKTQMKR IENATSRQVT FSKRRSGLLK KAFELSVLCD AEVALIVISP RGKLYEFASG  60
TGSVQKTIER YRTYTKDNVS SKTAQQDIEQ VKADAQGLAK KLEALEAYKR KLLGEKLEEC  120
SIEELHSLEV KLEKSLHCIR GRKTQLLEEQ VNKLKEKEMT LRKNNEDLRE KCKNQPPLTL  180
TPARPVITVE DDRPEQNDDD RMDVETELYL GLPGRDHRRN KVAEVRSG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A2e-16374271Myocyte-specific enhancer factor 2A
3kov_B2e-16374271Myocyte-specific enhancer factor 2A
3kov_I2e-16374271Myocyte-specific enhancer factor 2A
3kov_J2e-16374271Myocyte-specific enhancer factor 2A
3mu6_A2e-16374271Myocyte-specific enhancer factor 2A
3mu6_B2e-16374271Myocyte-specific enhancer factor 2A
3mu6_C2e-16374271Myocyte-specific enhancer factor 2A
3mu6_D2e-16374271Myocyte-specific enhancer factor 2A
3p57_A2e-16374271Myocyte-specific enhancer factor 2A
3p57_B2e-16374271Myocyte-specific enhancer factor 2A
3p57_C2e-16374271Myocyte-specific enhancer factor 2A
3p57_D2e-16374271Myocyte-specific enhancer factor 2A
3p57_I2e-16374271Myocyte-specific enhancer factor 2A
3p57_J2e-16374271Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.34880.0leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9607740.0EU960774.1 Zea mays clone 228490 MADS-box transcription factor 56 mRNA, complete cds.
GenBankEU9625040.0EU962504.1 Zea mays clone 243238 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985920.11e-143PREDICTED: MADS-box transcription factor 50 isoform X2
RefseqXP_012698462.11e-143PREDICTED: MADS-box transcription factor 50 isoform X2
RefseqXP_004985919.11e-143PREDICTED: MADS-box transcription factor 50 isoform X2
SwissprotQ9XJ601e-118MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLC5X0V91e-124C5X0V9_SORBI; Putative uncharacterized protein Sb01g049020
STRINGSb01g049020.11e-124(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.12e-72AGAMOUS-like 20